PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn038411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 355aa    MW: 37886.5 Da    PI: 8.1544
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn038411genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822194.82.9e-604517810149
      DUF822  10 kErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkssalaspve 108
                  ErEnnkrRERrRRaiaaki+ GLR++Gnyklpk++DnneVlkALc eAGw+ve+DGttyrkg++p e +++ag sa asp+ss++        +sp++
  Achn038411  45 NERENNKRRERRRRAIAAKIFGGLRMYGNYKLPKHCDNNEVLKALCDEAGWTVEPDGTTYRKGCRPAELMDIAGGSAAASPCSSYH--------PSPCA 135
                 7*************************************************************************************........***** PP

      DUF822 109 sysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                 sy++sp sssfpsp+s++ + +a+   +sl+p+l++ls++ ss
  Achn038411 136 SYNPSPGSSSFPSPASSSYAVNANLdgTSLIPWLKNLSSSASS 178
                 **************9988776665477**********986554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.5E-6145173IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MTSLSVSQSR VRPPPVVPIG GLRSSKTTNR FHERFPDSLL NFEINERENN KRRERRRRAI  60
AAKIFGGLRM YGNYKLPKHC DNNEVLKALC DEAGWTVEPD GTTYRKGCRP AELMDIAGGS  120
AAASPCSSYH PSPCASYNPS PGSSSFPSPA SSSYAVNANL DGTSLIPWLK NLSSSASSSA  180
SSPKFPHFYI HCGSISAPVT PPLSSPTART PRILTNAHYP LLPSSTPPSP GRQILPGPEW  240
LAGIRIPQTG PTSPTFSLVA SNPFGFRDEA MAGGGSRMWT PGQSGTCSPA IAAGSDHTAD  300
VPMCEVISDE FAFGSNTAGL VKAWEGERIH EECGSDDLEL TLGSSRTRFV VFDI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477843.11e-156PREDICTED: BES1/BZR1 homolog protein 4 isoform X1
RefseqXP_006477844.11e-156PREDICTED: BES1/BZR1 homolog protein 4 isoform X2
RefseqXP_010644097.11e-156PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV881e-132BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A067DLE11e-156A0A067DLE1_CITSI; Uncharacterized protein
STRINGVIT_19s0014g00870.t011e-149(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-104BES1/BZR1 homolog 4